PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011078582.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 397aa    MW: 44875.6 Da    PI: 6.4388
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011078582.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.69.1e-083343672154
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     k +yp++e++++L +++gL+ +q+ +WF N+R +
  XP_011078582.1 334 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 367
                     469*****************************87 PP

2ELK28.92.5e-10288309122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELKh+L+++Y+++++++++E++
  XP_011078582.1 288 ELKHELKQGYKEKIVDIREEIL 309
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012557.5E-20122166IPR005540KNOX1
PfamPF037901.6E-17124164IPR005540KNOX1
SMARTSM012565.9E-25176231IPR005541KNOX2
PfamPF037913.3E-18180230IPR005541KNOX2
PfamPF037899.1E-7288309IPR005539ELK domain
SMARTSM011886.1E-4288309IPR005539ELK domain
PROSITE profilePS512139.969288308IPR005539ELK domain
PROSITE profilePS5007111.726308371IPR001356Homeobox domain
SMARTSM003892.4E-11310375IPR001356Homeobox domain
SuperFamilySSF466893.85E-16310374IPR009057Homeodomain-like
CDDcd000861.79E-11311370No hitNo description
Gene3DG3DSA:1.10.10.602.3E-25315372IPR009057Homeodomain-like
PfamPF059201.1E-17328367IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGTCENRRIA NTDMAFQDHH HHHHLSQELP LHHPNYSDHP HPSVFRSLLP DHHPSTEDKP  60
PAPPTSTTTW LNSSTLHHQW LPTQSQPSPP TPPDNNDHIQ DSAGGGRDNS GSNGNNTNWE  120
REKCKADILN HPLYEQLLSA HVSCLRIATP VDQLPRIDAQ LAQSSQVVAK YSVLGHGQQP  180
LDDKDLDNFM THYVLLLSSF KEQLQQHVRV HAMEAVMACW ELEQSLQSLT GVAPGEGTGA  240
TMSDDDEDQA DSETNLFDES LDGPDSMGFG PLVPTETERS LMERVRQELK HELKQGYKEK  300
IVDIREEILR KRRAGKLPGD TTSVLKAWWQ SHSKWPYPTE EDKARLVQET GLQLKQINNW  360
FINQRKRNWH SNPSSSSSQK SKRKSGAGDK TANDRFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12311375872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078582.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotO223001e-170LET12_SOLLC; Homeobox protein knotted-1-like LET12
TrEMBLA0A022QCD30.0A0A022QCD3_ERYGU; Uncharacterized protein
STRINGVIT_04s0008g06130.t011e-178(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-159KNOTTED1-like homeobox gene 3